SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4ac9d1 (4ac9 D:180-271)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054227Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2054228Family b.43.3.1: Elongation factors [50448] (10 protein domains)
  6. 2054286Protein Elongation factor SelB, domains 2 and 4 [117218] (1 species)
    EF-Tu homologue, contains extra C-terminal domain (domain 4) of the same fold as the postG domain 2
  7. 2054287Species Methanococcus maripaludis [TaxId:39152] [117219] (3 PDB entries)
    Uniprot Q8J307
  8. 2054294Domain d4ac9d1: 4ac9 D:180-271 [192257]
    Other proteins in same PDB: d4ac9a3, d4ac9a4, d4ac9a5, d4ac9b3, d4ac9b4, d4ac9c3, d4ac9c4, d4ac9c5, d4ac9d3, d4ac9d4
    protein/RNA complex; complexed with 5gp, dxc, gdp, mg, so4

Details for d4ac9d1

PDB Entry: 4ac9 (more details), 3.03 Å

PDB Description: crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with gdp
PDB Compounds: (D:) mj0495-like protein

SCOPe Domain Sequences for d4ac9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ac9d1 b.43.3.1 (D:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]}
rntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesv
meakagdrvgmaiqgvdakqiyrgciltskdt

SCOPe Domain Coordinates for d4ac9d1:

Click to download the PDB-style file with coordinates for d4ac9d1.
(The format of our PDB-style files is described here.)

Timeline for d4ac9d1: