Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (6 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Elongation factor SelB, domains 2 and 4 [117218] (1 species) EF-Tu homologue, contains extra C-terminal domain (domain 4) of the same fold as the postG domain 2 |
Species Methanococcus maripaludis [TaxId:39152] [117219] (3 PDB entries) Uniprot Q8J307 |
Domain d4ac9b1: 4ac9 B:180-271 [192249] Other proteins in same PDB: d4ac9a3, d4ac9a4, d4ac9b3, d4ac9b4, d4ac9c3, d4ac9c4, d4ac9d3, d4ac9d4 protein/RNA complex; complexed with 5gp, dxc, gdp, mg, so4 |
PDB Entry: 4ac9 (more details), 3.03 Å
SCOPe Domain Sequences for d4ac9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ac9b1 b.43.3.1 (B:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} rntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesv meakagdrvgmaiqgvdakqiyrgciltskdt
Timeline for d4ac9b1: