SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4ac9a4 (4ac9 A:1-179)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110444Protein Elongation factor SelB, N-terminal domain [117537] (1 species)
  7. 2110445Species Methanococcus maripaludis [TaxId:39152] [117538] (3 PDB entries)
    Uniprot Q8J307
  8. 2110446Domain d4ac9a4: 4ac9 A:1-179 [192248]
    Other proteins in same PDB: d4ac9a1, d4ac9a2, d4ac9a3, d4ac9a5, d4ac9b1, d4ac9b2, d4ac9b3, d4ac9c1, d4ac9c2, d4ac9c3, d4ac9c5, d4ac9d1, d4ac9d2, d4ac9d3
    protein/RNA complex; complexed with 5gp, dxc, gdp, mg, so4

Details for d4ac9a4

PDB Entry: 4ac9 (more details), 3.03 Å

PDB Description: crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with gdp
PDB Compounds: (A:) mj0495-like protein

SCOPe Domain Sequences for d4ac9a4:

Sequence, based on SEQRES records: (download)

>d4ac9a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}
mdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyr
itlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitk
sdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii

Sequence, based on observed residues (ATOM records): (download)

>d4ac9a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}
mdfkninlgifghidhgkttlskvlteigfsafklenyritlvdapghadliravvsaad
iidlalivvdakegpktqtgehmlildhfnipiivvitksdnagteeikrtemimksilq
sthnlknssiipisaktgfgvdelknliittlnnaeii

SCOPe Domain Coordinates for d4ac9a4:

Click to download the PDB-style file with coordinates for d4ac9a4.
(The format of our PDB-style files is described here.)

Timeline for d4ac9a4: