SCOP 1.55: Domain d2occe_: 2occ E:

Lineage for d2occe_ (2occ E:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)

4. Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family)

5. Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)

6. Protein Cytochrome c oxidase subunit E [48481] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48482] (5 PDB entries)

8. Domain d2occe_: 2occ E: [19224]
   Other proteins in same PDB: d2occa1, d2occb1, d2occb2, d2occc1, d2occd1, d2occf_, d2occg1, d2occh_, d2occi1, d2occj1, d2occk1, d2occl1, d2occm1, d2occn1, d2occo1, d2occo2, d2occp1, d2occq1, d2occs_, d2occt1, d2occu_, d2occv1, d2occw1, d2occx1, d2occy1, d2occz1

Details for d2occe_

PDB Entry: 2occ, 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d2occe_:

Sequence; same for both SEQRES and ATOM records:

>d2occe_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus)}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

Timeline for d2occe_:

• d2occe_ appears in SCOP 1.57
  
• d2occe_ appears in the current release, SCOPe 2.08