Lineage for d4a6bb_ (4a6b B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2391027Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2392314Protein automated matches [190433] (11 species)
    not a true protein
  7. 2392433Species Human immunodeficiency virus [TaxId:12721] [188065] (13 PDB entries)
  8. 2392441Domain d4a6bb_: 4a6b B: [192229]
    automated match to d2wl0a_
    complexed with qg8

Details for d4a6bb_

PDB Entry: 4a6b (more details), 1.8 Å

PDB Description: stereoselective synthesis, x-ray analysis, and biological evaluation of a new class of lactam based hiv-1 protease inhibitors
PDB Compounds: (B:) pol protein

SCOPe Domain Sequences for d4a6bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a6bb_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

SCOPe Domain Coordinates for d4a6bb_:

Click to download the PDB-style file with coordinates for d4a6bb_.
(The format of our PDB-style files is described here.)

Timeline for d4a6bb_: