SCOPe 2.08: Domain d4a6bb_: 4a6b B:

Lineage for d4a6bb_ (4a6b B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (12 species)
   not a true protein

7. Species Human immunodeficiency virus [TaxId:12721] [188065] (13 PDB entries)

8. Domain d4a6bb_: 4a6b B: [192229]
   automated match to d2wl0a_
   complexed with qg8

Details for d4a6bb_

PDB Entry: 4a6b, 1.8 Å

PDB Description: stereoselective synthesis, x-ray analysis, and biological evaluation of a new class of lactam based hiv-1 protease inhibitors

PDB Compounds: (B:) pol protein

SCOPe Domain Sequences for d4a6bb_:

Sequence; same for both SEQRES and ATOM records:

>d4a6bb_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

Timeline for d4a6bb_:

• d4a6bb_ first appeared in SCOPe 2.02
  
• d4a6bb_ appears in SCOPe 2.07