Lineage for d4a2yb_ (4a2y B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2174483Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2174484Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2174485Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2174569Protein Eosinophil cationic protein (ECP), ribonuclease 3 [54090] (1 species)
  7. 2174570Species Human (Homo sapiens) [TaxId:9606] [54091] (11 PDB entries)
  8. 2174576Domain d4a2yb_: 4a2y B: [192227]
    automated match to d1dyta_
    complexed with cit, mpd

Details for d4a2yb_

PDB Entry: 4a2y (more details), 1.7 Å

PDB Description: structure of the human eosinophil cationic protein in complex with citrate anions
PDB Compounds: (B:) eosinophil cationic protein

SCOPe Domain Sequences for d4a2yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a2yb_ d.5.1.1 (B:) Eosinophil cationic protein (ECP), ribonuclease 3 {Human (Homo sapiens) [TaxId: 9606]}
rppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqsi
rcphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprdsp
rypvvpvhldtti

SCOPe Domain Coordinates for d4a2yb_:

Click to download the PDB-style file with coordinates for d4a2yb_.
(The format of our PDB-style files is described here.)

Timeline for d4a2yb_: