SCOPe 2.05: Domain d4a2ya_: 4a2y A:

Lineage for d4a2ya_ (4a2y A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Eosinophil cationic protein (ECP), ribonuclease 3 [54090] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54091] (11 PDB entries)

8. Domain d4a2ya_: 4a2y A: [192226]
   automated match to d1dyta_
   complexed with cit, mpd

Details for d4a2ya_

PDB Entry: 4a2y, 1.7 Å

PDB Description: structure of the human eosinophil cationic protein in complex with citrate anions

PDB Compounds: (A:) eosinophil cationic protein

SCOPe Domain Sequences for d4a2ya_:

Sequence; same for both SEQRES and ATOM records:

>d4a2ya_ d.5.1.1 (A:) Eosinophil cationic protein (ECP), ribonuclease 3 {Human (Homo sapiens) [TaxId: 9606]}
rppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqsi
rcphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprdsp
rypvvpvhldtti

Timeline for d4a2ya_:

• d4a2ya_ first appeared in SCOPe 2.02
  
• d4a2ya_ appears in SCOPe 2.04
  
• d4a2ya_ appears in SCOPe 2.06
  
• d4a2ya_ appears in the current release, SCOPe 2.08