Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein Eosinophil cationic protein (ECP), ribonuclease 3 [54090] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54091] (11 PDB entries) |
Domain d4a2oa_: 4a2o A: [192224] automated match to d1dyta_ complexed with so4 |
PDB Entry: 4a2o (more details), 1.69 Å
SCOPe Domain Sequences for d4a2oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a2oa_ d.5.1.1 (A:) Eosinophil cationic protein (ECP), ribonuclease 3 {Human (Homo sapiens) [TaxId: 9606]} rppqftraqwfaiqhislnpprctiamrainnyrwrcknqntflrttfanvvnvcgnqsi rcphnrtlnnchrsrfrvpllhcdlinpgaqnisncryadrpgrrfyvvacdnrdprdsp rypvvpvhldtti
Timeline for d4a2oa_: