Lineage for d3zyfd_ (3zyf D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1116326Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1116327Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1116758Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein)
    a truncated form of this fold lacking one of the N-terminal strands
  6. 1116759Protein PA-IL, galactose-binding lectin 1 [82023] (1 species)
  7. 1116760Species Pseudomonas aeruginosa [TaxId:287] [82024] (9 PDB entries)
  8. 1116803Domain d3zyfd_: 3zyf D: [192223]
    automated match to d1l7la_
    complexed with 147, ca

Details for d3zyfd_

PDB Entry: 3zyf (more details), 1.94 Å

PDB Description: crystal structure of pa-il lectin complexed with npg at 1.9 a resolution
PDB Compounds: (D:) PA-I galactophilic lectin

SCOPe Domain Sequences for d3zyfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zyfd_ b.18.1.16 (D:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

SCOPe Domain Coordinates for d3zyfd_:

Click to download the PDB-style file with coordinates for d3zyfd_.
(The format of our PDB-style files is described here.)

Timeline for d3zyfd_: