Class a: All alpha proteins [46456] (290 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (3 families) Heme-containing proteins |
Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins) automatically mapped to Pfam PF01322 |
Protein automated matches [190363] (5 species) not a true protein |
Species Achromobacter xylosoxidans [TaxId:85698] [189489] (29 PDB entries) |
Domain d3zwia_: 3zwi A: [192215] automated match to d2xlma_ complexed with asc, cmo, hec, so4 |
PDB Entry: 3zwi (more details), 1.25 Å
SCOPe Domain Sequences for d3zwia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zwia_ a.24.3.2 (A:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]} efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach dayrkk
Timeline for d3zwia_: