SCOPe 2.07: Domain d3vnpc1: 3vnp C:1-170

Lineage for d3vnpc1 (3vnp C:1-170)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (4 proteins)
   archaeal hexapeptide repeat proteins
   this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain

6. Protein automated matches [190628] (1 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [187665] (2 PDB entries)

8. Domain d3vnpc1: 3vnp C:1-170 [192212]
   Other proteins in same PDB: d3vnpa2, d3vnpb2, d3vnpc2
   complexed with acy, mg

Details for d3vnpc1

PDB Entry: 3vnp, 2.4 Å

PDB Description: crystal structure of hypothetical protein (gk2848) from geobacillus kaustophilus

PDB Compounds: (C:) Hypothetical conserved protein

SCOPe Domain Sequences for d3vnpc1:

Sequence; same for both SEQRES and ATOM records:

>d3vnpc1 b.81.1.5 (C:1-170) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
miypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqdn
silhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagslv
ppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqq

Timeline for d3vnpc1:

• d3vnpc1 first appeared in SCOPe 2.02, called d3vnpc_
  
• d3vnpc1 appears in SCOPe 2.06
  
• d3vnpc1 appears in the current release, SCOPe 2.08