Lineage for d3vnpc_ (3vnp C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1137720Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1137721Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1137884Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (4 proteins)
    archaeal hexapeptide repeat proteins
    this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain
  6. 1137909Protein automated matches [190628] (1 species)
    not a true protein
  7. 1137910Species Geobacillus kaustophilus [TaxId:1462] [187665] (1 PDB entry)
  8. 1137913Domain d3vnpc_: 3vnp C: [192212]
    complexed with acy, mg

Details for d3vnpc_

PDB Entry: 3vnp (more details), 2.4 Å

PDB Description: crystal structure of hypothetical protein (gk2848) from geobacillus kaustophilus
PDB Compounds: (C:) Hypothetical conserved protein

SCOPe Domain Sequences for d3vnpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vnpc_ b.81.1.5 (C:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
gmiypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqd
nsilhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagsl
vppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqq

SCOPe Domain Coordinates for d3vnpc_:

Click to download the PDB-style file with coordinates for d3vnpc_.
(The format of our PDB-style files is described here.)

Timeline for d3vnpc_: