Lineage for d3vnpb_ (3vnp B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806519Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1806520Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1806705Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (4 proteins)
    archaeal hexapeptide repeat proteins
    this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain
  6. 1806730Protein automated matches [190628] (1 species)
    not a true protein
  7. 1806731Species Geobacillus kaustophilus [TaxId:1462] [187665] (1 PDB entry)
  8. 1806733Domain d3vnpb_: 3vnp B: [192211]
    complexed with acy, mg

Details for d3vnpb_

PDB Entry: 3vnp (more details), 2.4 Å

PDB Description: crystal structure of hypothetical protein (gk2848) from geobacillus kaustophilus
PDB Compounds: (B:) Hypothetical conserved protein

SCOPe Domain Sequences for d3vnpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vnpb_ b.81.1.5 (B:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
gmiypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqd
nsilhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagsl
vppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqq

SCOPe Domain Coordinates for d3vnpb_:

Click to download the PDB-style file with coordinates for d3vnpb_.
(The format of our PDB-style files is described here.)

Timeline for d3vnpb_: