| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Myoglobin [46469] (11 species) |
| Species Horse (Equus caballus) [TaxId:9796] [46474] (96 PDB entries) |
| Domain d3vaua_: 3vau A: [192199] automated match to d1gjna_ complexed with no2, nte, so4 |
PDB Entry: 3vau (more details), 1.7 Å
SCOPe Domain Sequences for d3vaua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vaua_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgf
Timeline for d3vaua_: