Lineage for d3urla_ (3url A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320913Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1320914Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1322142Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1322698Protein Endothiapepsin [50647] (1 species)
  7. 1322699Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (46 PDB entries)
  8. 1322726Domain d3urla_: 3url A: [192192]
    automated match to d1oewa_
    complexed with so4

Details for d3urla_

PDB Entry: 3url (more details), 2 Å

PDB Description: Endothiapepsin-DB6 complex.
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d3urla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3urla_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d3urla_:

Click to download the PDB-style file with coordinates for d3urla_.
(The format of our PDB-style files is described here.)

Timeline for d3urla_: