SCOPe 2.07: Domain d3un8y_: 3un8 Y:

Lineage for d3un8y_ (3un8 Y:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3un8y_: 3un8 Y: [192187]
   Other proteins in same PDB: d3un8b_, d3un8c_, d3un8d_, d3un8e_, d3un8f_, d3un8g_, d3un8h_, d3un8p_, d3un8q_, d3un8r_, d3un8s_, d3un8t_, d3un8u_, d3un8v_
   automated match to d1g0uk_
   complexed with 049

Details for d3un8y_

PDB Entry: 3un8, 2.7 Å

PDB Description: Yeast 20S proteasome in complex with PR-957 (epoxide)

PDB Compounds: (Y:) Proteasome component PRE2

SCOPe Domain Sequences for d3un8y_:

Sequence; same for both SEQRES and ATOM records:

>d3un8y_ d.153.1.4 (Y:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

Timeline for d3un8y_:

• d3un8y_ first appeared in SCOPe 2.02
  
• d3un8y_ appears in SCOPe 2.06
  
• d3un8y_ appears in the current release, SCOPe 2.08