Lineage for d1elkb_ (1elk B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010991Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2011006Family a.118.9.2: VHS domain [48468] (6 proteins)
  6. 2011041Protein Tom1 protein [48471] (1 species)
  7. 2011042Species Human (Homo sapiens) [TaxId:9606] [48472] (1 PDB entry)
  8. 2011044Domain d1elkb_: 1elk B: [19218]

Details for d1elkb_

PDB Entry: 1elk (more details), 1.5 Å

PDB Description: vhs domain of tom1 protein from h. sapiens
PDB Compounds: (B:) target of myb1

SCOPe Domain Sequences for d1elkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elkb_ a.118.9.2 (B:) Tom1 protein {Human (Homo sapiens) [TaxId: 9606]}
sdfllgnpfsspvgqriekatdgslqsedwalnmeicdiineteegpkdalravkkrivg
nknfhevmlaltvletcvkncghrfhvlvasqdfvesvlvrtilpknnpptivhdkvlnl
iqswadafrsspdltgvvtiyedlrrkglefpm

SCOPe Domain Coordinates for d1elkb_:

Click to download the PDB-style file with coordinates for d1elkb_.
(The format of our PDB-style files is described here.)

Timeline for d1elkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1elka_