SCOPe 2.05: Domain d3uilb_: 3uil B:

Lineage for d3uilb_ (3uil B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
   Family 2 zinc amidase;

6. Protein automated matches [190549] (4 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (32 PDB entries)

8. Domain d3uilb_: 3uil B: [192171]
   automated match to d2r90a_
   complexed with dao, gol

Details for d3uilb_

PDB Entry: 3uil, 2.2 Å

PDB Description: Crystal Structure of the complex of PGRP-S with lauric acid at 2.2 A resolution

PDB Compounds: (B:) Peptidoglycan recognition protein 1

SCOPe Domain Sequences for d3uilb_:

Sequence; same for both SEQRES and ATOM records:

>d3uilb_ d.118.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

Timeline for d3uilb_:

• d3uilb_ first appeared in SCOPe 2.02
  
• d3uilb_ appears in SCOPe 2.04
  
• d3uilb_ appears in SCOPe 2.06
  
• d3uilb_ appears in the current release, SCOPe 2.08