Lineage for d3uila_ (3uil A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1216883Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 1216884Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 1216885Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 1216946Protein automated matches [190549] (3 species)
    not a true protein
  7. 1216947Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (23 PDB entries)
  8. 1216976Domain d3uila_: 3uil A: [192170]
    automated match to d2r90a_
    complexed with dao, gol

Details for d3uila_

PDB Entry: 3uil (more details), 2.2 Å

PDB Description: Crystal Structure of the complex of PGRP-S with lauric acid at 2.2 A resolution
PDB Compounds: (A:) Peptidoglycan recognition protein 1

SCOPe Domain Sequences for d3uila_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uila_ d.118.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

SCOPe Domain Coordinates for d3uila_:

Click to download the PDB-style file with coordinates for d3uila_.
(The format of our PDB-style files is described here.)

Timeline for d3uila_: