Lineage for d1elka_ (1elk A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340111Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2340126Family a.118.9.2: VHS domain [48468] (6 proteins)
  6. 2340161Protein Tom1 protein [48471] (1 species)
  7. 2340162Species Human (Homo sapiens) [TaxId:9606] [48472] (1 PDB entry)
  8. 2340163Domain d1elka_: 1elk A: [19217]

Details for d1elka_

PDB Entry: 1elk (more details), 1.5 Å

PDB Description: vhs domain of tom1 protein from h. sapiens
PDB Compounds: (A:) target of myb1

SCOPe Domain Sequences for d1elka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elka_ a.118.9.2 (A:) Tom1 protein {Human (Homo sapiens) [TaxId: 9606]}
sdfllgnpfsspvgqriekatdgslqsedwalnmeicdiineteegpkdalravkkrivg
nknfhevmlaltvletcvkncghrfhvlvasqdfvesvlvrtilpknnpptivhdkvlnl
iqswadafrsspdltgvvtiyedlrrkglefpm

SCOPe Domain Coordinates for d1elka_:

Click to download the PDB-style file with coordinates for d1elka_.
(The format of our PDB-style files is described here.)

Timeline for d1elka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1elkb_