SCOPe 2.07: Domain d3u7ma1: 3u7m A:1-183

Lineage for d3u7ma1 (3u7m A:1-183)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein automated matches [190200] (10 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [192454] (4 PDB entries)

8. Domain d3u7ma1: 3u7m A:1-183 [192166]
   Other proteins in same PDB: d3u7ma2
   automated match to d1lmha_
   complexed with fhf, zn

Details for d3u7ma1

PDB Entry: 3u7m, 2.15 Å

PDB Description: crystal structures of the staphylococcus aureus peptide deformylase in complex with two classes of new inhibitors

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d3u7ma1:

Sequence; same for both SEQRES and ATOM records:

>d3u7ma1 d.167.1.1 (A:1-183) automated matches {Staphylococcus aureus [TaxId: 93062]}
mltmkdiirdghptlrqkaaelelpltkeeketliamreflvnsqdeeiakryglrsgvg
laapqiniskrmiavlipddgsgksydymlvnpkivshsvqeaylptgegclsvddnvag
lvhrhnritikakdiegndiqlrlkgypaivfqheidhlngvmfydhidkdhplqphtda
vev

Timeline for d3u7ma1:

• d3u7ma1 first appeared in SCOPe 2.02, called d3u7ma_
  
• d3u7ma1 appears in SCOPe 2.06
  
• d3u7ma1 appears in the current release, SCOPe 2.08