| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
| Protein Mitochondrial cytochrome c [46642] (6 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (46 PDB entries) Uniprot P00044 |
| Domain d3tyia_: 3tyi A: [192162] automated match to d2ycca_ complexed with hem, t3y |
PDB Entry: 3tyi (more details), 1.4 Å
SCOPe Domain Sequences for d3tyia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tyia_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
Timeline for d3tyia_: