Lineage for d1dvpa1 (1dvp A:1-145)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1746326Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 1746335Family a.118.9.2: VHS domain [48468] (6 proteins)
  6. 1746367Protein Hrs [48469] (1 species)
    protein involved in membrane trafficking and signal transduction
  7. 1746368Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [48470] (1 PDB entry)
  8. 1746369Domain d1dvpa1: 1dvp A:1-145 [19216]
    Other proteins in same PDB: d1dvpa2
    complexed with cit, zn

Details for d1dvpa1

PDB Entry: 1dvp (more details), 2 Å

PDB Description: crystal structure of the vhs and fyve tandem domains of hrs, a protein involved in membrane trafficking and signal transduction
PDB Compounds: (A:) hepatocyte growth factor-regulated tyrosine kinase substrate

SCOPe Domain Sequences for d1dvpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mfrssfcknlenatshlrlepdwpsillicdeinqkdvtpknafaaikkkmnspnphssc
ysllvlesivkncgapvheevftkencemfssflestphenvrqkmlelvqtwayafrss
dkyqaikdtmtilkakghtfpelre

SCOPe Domain Coordinates for d1dvpa1:

Click to download the PDB-style file with coordinates for d1dvpa1.
(The format of our PDB-style files is described here.)

Timeline for d1dvpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dvpa2