![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
![]() | Family a.118.9.2: VHS domain [48468] (6 proteins) |
![]() | Protein Hrs [48469] (1 species) protein involved in membrane trafficking and signal transduction |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [48470] (1 PDB entry) |
![]() | Domain d1dvpa1: 1dvp A:1-145 [19216] Other proteins in same PDB: d1dvpa2 complexed with cit, zn |
PDB Entry: 1dvp (more details), 2 Å
SCOPe Domain Sequences for d1dvpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} mfrssfcknlenatshlrlepdwpsillicdeinqkdvtpknafaaikkkmnspnphssc ysllvlesivkncgapvheevftkencemfssflestphenvrqkmlelvqtwayafrss dkyqaikdtmtilkakghtfpelre
Timeline for d1dvpa1: