Lineage for d3ts4a1 (3ts4 A:106-263)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570846Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2571256Protein automated matches [190182] (1 species)
    not a true protein
  7. 2571257Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)
  8. 2571270Domain d3ts4a1: 3ts4 A:106-263 [192159]
    Other proteins in same PDB: d3ts4a2
    automated match to d1os9a_
    complexed with ca, eeg, gol, imd, zn

Details for d3ts4a1

PDB Entry: 3ts4 (more details), 1.59 Å

PDB Description: Human MMP12 in complex with L-glutamate motif inhibitor
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d3ts4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ts4a1 d.92.1.11 (A:106-263) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d3ts4a1:

Click to download the PDB-style file with coordinates for d3ts4a1.
(The format of our PDB-style files is described here.)

Timeline for d3ts4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ts4a2