| Class b: All beta proteins [48724] (174 folds) |
| Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
| Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
| Protein Human immunodeficiency virus type 1 protease [50632] (8 species) |
| Domain d3tohb_: 3toh B: [192158] automated match to d1sdta_ complexed with 079, dms |
PDB Entry: 3toh (more details), 1.12 Å
SCOPe Domain Sequences for d3tohb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tohb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
Timeline for d3tohb_: