Lineage for d3toha_ (3toh A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320913Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1320914Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1320915Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1320931Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [194276] (19 PDB entries)
  8. 1321080Domain d3toha_: 3toh A: [192157]
    automated match to d1sdta_
    complexed with 079, dms

Details for d3toha_

PDB Entry: 3toh (more details), 1.12 Å

PDB Description: hiv-1 protease - epoxydic inhibitor complex (ph 9 - orthorombic crystal form p212121)
PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d3toha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3toha_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d3toha_:

Click to download the PDB-style file with coordinates for d3toha_.
(The format of our PDB-style files is described here.)

Timeline for d3toha_: