Lineage for d3togb_ (3tog B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1548219Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1548235Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [194276] (20 PDB entries)
  8. 1548406Domain d3togb_: 3tog B: [192154]
    automated match to d1sdta_
    complexed with 079, dms

Details for d3togb_

PDB Entry: 3tog (more details), 1.24 Å

PDB Description: hiv-1 protease - epoxydic inhibitor complex (ph 9 - monoclinic crystal form p21)
PDB Compounds: (B:) Gag-Pol polyprotein

SCOPe Domain Sequences for d3togb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3togb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d3togb_:

Click to download the PDB-style file with coordinates for d3togb_.
(The format of our PDB-style files is described here.)

Timeline for d3togb_: