Lineage for d1edua_ (1edu A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies) Superfamily a.118.9: ENTH/VHS domain [48464] (2 families) 
Family a.118.9.1: ENTH domain [48465] (1 protein) Protein Epsin 1 [48466] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [48467] (2 PDB entries) 
Domain d1edua_: 1edu A: [19215]
Details for d1edua_
PDB Entry: 1edu (more details), 1.8 Å
PDB Description: crystal structure of the enth domain of rat epsin 1
SCOP Domain Sequences for d1edua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1edua_ a.118.9.1 (A:) Epsin 1 {Rat (Rattus norvegicus)}
nivhnyseaeikvreatsndpwgpssslmseiadltynvvafseimsmiwkrlndhgknw
rhvykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdgkdqgvnvrekakqlv
allrdedrlreerahalktkeklaqtata
SCOP Domain Coordinates for d1edua_:
Click to download the PDB-style file with coordinates for d1edua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1edua_:
- d1edua_ appears in SCOP 1.57
- d1edua_ appears in the current release, SCOPe 2.08
View in 3D