Lineage for d1edua_ (1edu A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6242Superfamily a.118.9: ENTH/VHS domain [48464] (2 families) (S)
  5. 6243Family a.118.9.1: ENTH domain [48465] (1 protein)
  6. 6244Protein Epsin 1 [48466] (1 species)
  7. 6245Species Rat (Rattus norvegicus) [TaxId:10116] [48467] (2 PDB entries)
  8. 6247Domain d1edua_: 1edu A: [19215]

Details for d1edua_

PDB Entry: 1edu (more details), 1.8 Å

PDB Description: crystal structure of the enth domain of rat epsin 1

SCOP Domain Sequences for d1edua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edua_ a.118.9.1 (A:) Epsin 1 {Rat (Rattus norvegicus)}
nivhnyseaeikvreatsndpwgpssslmseiadltynvvafseimsmiwkrlndhgknw
rhvykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdgkdqgvnvrekakqlv
allrdedrlreerahalktkeklaqtata

SCOP Domain Coordinates for d1edua_:

Click to download the PDB-style file with coordinates for d1edua_.
(The format of our PDB-style files is described here.)

Timeline for d1edua_: