SCOPe 2.08: Domain d1edua_: 1edu A:

Lineage for d1edua_ (1edu A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.1: ENTH domain [48465] (2 proteins)
   automatically mapped to Pfam PF01417

6. Protein Epsin 1 [48466] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48467] (3 PDB entries)

8. Domain d1edua_: 1edu A: [19215]
   complexed with edo

Details for d1edua_

PDB Entry: 1edu, 1.8 Å

PDB Description: crystal structure of the enth domain of rat epsin 1

PDB Compounds: (A:) EH domain binding protein EPSIN

SCOPe Domain Sequences for d1edua_:

Sequence; same for both SEQRES and ATOM records:

>d1edua_ a.118.9.1 (A:) Epsin 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nivhnyseaeikvreatsndpwgpssslmseiadltynvvafseimsmiwkrlndhgknw
rhvykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdgkdqgvnvrekakqlv
allrdedrlreerahalktkeklaqtata

Timeline for d1edua_:

• d1edua_ first appeared (with stable ids) in SCOP 1.55
  
• d1edua_ appears in SCOPe 2.07