Lineage for d1edua_ (1edu A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. Family a.118.9.1: ENTH domain [48465] (2 proteins)
    automatically mapped to Pfam PF01417
  6. Protein Epsin 1 [48466] (2 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48467] (3 PDB entries)
  8. Domain d1edua_: 1edu A: [19215]
    complexed with edo

Details for d1edua_

PDB Entry: 1edu (more details), 1.8 Å

PDB Description: crystal structure of the enth domain of rat epsin 1
PDB Compounds: (A:) EH domain binding protein EPSIN

SCOPe Domain Sequences for d1edua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edua_ a.118.9.1 (A:) Epsin 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nivhnyseaeikvreatsndpwgpssslmseiadltynvvafseimsmiwkrlndhgknw
rhvykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdgkdqgvnvrekakqlv
allrdedrlreerahalktkeklaqtata

SCOPe Domain Coordinates for d1edua_ are not available.

Timeline for d1edua_: