![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Coagulation factor VIIa [50550] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50551] (89 PDB entries) Uniprot P08709 213-466 ! Uniprot P08709 213-446 |
![]() | Domain d3th2h_: 3th2 H: [192144] Other proteins in same PDB: d3th2l1, d3th2l2, d3th2l3, d3th2t1, d3th2t2 automated match to d1klih_ complexed with ben, bgc, ca, cl, fuc, mg, na |
PDB Entry: 3th2 (more details), 1.72 Å
SCOPe Domain Sequences for d3th2h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3th2h_ b.47.1.2 (H:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
Timeline for d3th2h_: