| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (94 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:575584] [189578] (10 PDB entries) |
| Domain d3tceb_: 3tce B: [192142] automated match to d3puda_ complexed with lyz |
PDB Entry: 3tce (more details), 2.6 Å
SCOPe Domain Sequences for d3tceb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tceb_ c.1.10.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
tiqgsivaivtpmlkdggvdwksleklvewhieqgtnsivavgttgeastlsmeehtqvi
keiirvankripiiagtganstreaieltkaakdlgadaallvtpyynkptqeglyqhyk
aiaeavelplilynvpgrtgvdlsndtavrlaeipnivgikdatgdvprgkalidalngk
mavysgddetawelmllgadgnisvtaniapkamsevcavaiakdeqqaktlnnkianlh
nilfcesnpipvkwalhemglidtgirlpltplaeqyreplrnalkdagii
Timeline for d3tceb_: