Lineage for d1eyha_ (1eyh A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50498Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 50733Superfamily a.118.9: ENTH/VHS domain [48464] (2 families) (S)
  5. 50734Family a.118.9.1: ENTH domain [48465] (1 protein)
  6. 50735Protein Epsin 1 [48466] (2 species)
  7. 50738Species Rat (Rattus norvegicus) [TaxId:10116] [48467] (2 PDB entries)
  8. 50739Domain d1eyha_: 1eyh A: [19214]

Details for d1eyha_

PDB Entry: 1eyh (more details), 1.56 Å

PDB Description: crystal structure of the epsin n-terminal homology (enth) domain at 1.56 angstrom resolution

SCOP Domain Sequences for d1eyha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eyha_ a.118.9.1 (A:) Epsin 1 {Rat (Rattus norvegicus)}
hnyseaeikvreatsndpwgpssslmseiadltynvvafseimsmiwkrlndhgknwrhv
ykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdgkdqgvnvrekakqlvall
rdedrlreerahalktkeklaqta

SCOP Domain Coordinates for d1eyha_:

Click to download the PDB-style file with coordinates for d1eyha_.
(The format of our PDB-style files is described here.)

Timeline for d1eyha_: