Lineage for d1fchb_ (1fch B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6222Superfamily a.118.8: Tetratricopeptide repeat (TPR) [48452] (1 family) (S)
  5. 6223Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (5 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 6232Protein Peroxisomal targeting signal 1 (PTS1) receptor Pex-5 [48462] (1 species)
  7. 6233Species Human (Homo sapiens) [TaxId:9606] [48463] (1 PDB entry)
  8. 6235Domain d1fchb_: 1fch B: [19213]

Details for d1fchb_

PDB Entry: 1fch (more details), 2.2 Å

PDB Description: crystal structure of the pts1 complexed to the tpr region of human pex5

SCOP Domain Sequences for d1fchb_:

Sequence, based on SEQRES records: (download)

>d1fchb_ a.118.8.1 (B:) Peroxisomal targeting signal 1 (PTS1) receptor Pex-5 {Human (Homo sapiens)}
kgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqae
neqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvt
paeegaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnls
geydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsryn
lgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrlalsmlgqsdayg
aadardlstlltmfglpq

Sequence, based on observed residues (ATOM records): (download)

>d1fchb_ a.118.8.1 (B:) Peroxisomal targeting signal 1 (PTS1) receptor Pex-5 {Human (Homo sapiens)}
kgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqae
neqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvt
prilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcftaal
svrpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlgahrea
vehflealnmqrksgamseniwstlrlalsmlgqsdaygaadardlstlltmfglpq

SCOP Domain Coordinates for d1fchb_:

Click to download the PDB-style file with coordinates for d1fchb_.
(The format of our PDB-style files is described here.)

Timeline for d1fchb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fcha_