Lineage for d1fchb_ (1fch B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007337Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 protein domains)
  6. 2007418Protein Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) [48462] (2 species)
  7. 2007419Species Human (Homo sapiens) [TaxId:9606] [48463] (1 PDB entry)
  8. 2007421Domain d1fchb_: 1fch B: [19213]
    complexed with the pts1 peptide

Details for d1fchb_

PDB Entry: 1fch (more details), 2.2 Å

PDB Description: crystal structure of the pts1 complexed to the tpr region of human pex5
PDB Compounds: (B:) peroxisomal targeting signal 1 receptor

SCOPe Domain Sequences for d1fchb_:

Sequence, based on SEQRES records: (download)

>d1fchb_ a.118.8.1 (B:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}
kgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqae
neqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvt
paeegaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnls
geydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsryn
lgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrlalsmlgqsdayg
aadardlstlltmfglpq

Sequence, based on observed residues (ATOM records): (download)

>d1fchb_ a.118.8.1 (B:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}
kgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqae
neqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvt
prilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcftaal
svrpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlgahrea
vehflealnmqrksgamseniwstlrlalsmlgqsdaygaadardlstlltmfglpq

SCOPe Domain Coordinates for d1fchb_:

Click to download the PDB-style file with coordinates for d1fchb_.
(The format of our PDB-style files is described here.)

Timeline for d1fchb_: