![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) [48462] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48463] (1 PDB entry) |
![]() | Domain d1fchb_: 1fch B: [19213] complexed with the pts1 peptide applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1fch (more details), 2.2 Å
SCOPe Domain Sequences for d1fchb_:
Sequence, based on SEQRES records: (download)
>d1fchb_ a.118.8.1 (B:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} kgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqae neqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvt paeegaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnls geydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsryn lgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrlalsmlgqsdayg aadardlstlltmfglpq
>d1fchb_ a.118.8.1 (B:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} kgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqae neqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvt prilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcftaal svrpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlgahrea vehflealnmqrksgamseniwstlrlalsmlgqsdaygaadardlstlltmfglpq
Timeline for d1fchb_: