Lineage for d1e96b_ (1e96 B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775786Superfamily a.118.8: TPR-like [48452] (8 families) (S)
  5. 775787Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 775828Protein Neutrophil cytosolic factor 2 (NCF-2, p67-phox) [48460] (1 species)
  7. 775829Species Human (Homo sapiens) [TaxId:9606] [48461] (3 PDB entries)
  8. 775832Domain d1e96b_: 1e96 B: [19211]
    Other proteins in same PDB: d1e96a_
    complexed with gtp, mg; mutant

Details for d1e96b_

PDB Entry: 1e96 (more details), 2.4 Å

PDB Description: structure of the rac/p67phox complex
PDB Compounds: (B:) neutrophil cytosol factor 2 (ncf-2) tpr domain, residues 1-203

SCOP Domain Sequences for d1e96b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e96b_ a.118.8.1 (B:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}
slveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaft
rsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfac
evlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvgk
lfrpn

SCOP Domain Coordinates for d1e96b_:

Click to download the PDB-style file with coordinates for d1e96b_.
(The format of our PDB-style files is described here.)

Timeline for d1e96b_: