Lineage for d1qqea_ (1qqe A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007337Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 protein domains)
  6. 2007454Protein Vesicular transport protein sec17 [48458] (1 species)
  7. 2007455Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48459] (1 PDB entry)
  8. 2007456Domain d1qqea_: 1qqe A: [19210]

Details for d1qqea_

PDB Entry: 1qqe (more details), 2.9 Å

PDB Description: crystal structure of the vesicular transport protein sec17
PDB Compounds: (A:) vesicular transport protein sec17

SCOPe Domain Sequences for d1qqea_:

Sequence, based on SEQRES records: (download)

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isdpvellkraekkgvpssgfmklfsgsdsykfeeaadlcvqaatiyrlrkelnlagdsf
lkaadyqkkagnedeagntyveaykcfksggnsvnavdslenaiqifthrgqfrrganfk
felgeilendlhdyakaidcyelagewyaqdqsvalsnkcfikcadlkaldgqyieasdi
ysklikssmgnrlsqwslkdyflkkglcqlaatdavaaartlqegqsedpnfadsresnf
lkslidavnegdseqlsehckefdnfmrldkwkitilnkikesiqqqedd

Sequence, based on observed residues (ATOM records): (download)

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isdpvellkraekkgvpssgfmklfsgsdsykfeeaadlcvqaatiyrlrkelnlagdsf
lkaadyqkkagnedeagntyveaykcfksggnsvnavdslenaiqifthrgqfrrganfk
felgeilendlhdyakaidcyelagewyaqdqsvalsnkcfikcadlkaldgqyieasdi
ysklikssmgnrlsqwslkdyflkkglcqlaatdavaaartlqegqsesnflkslidavn
egdseqlsehckefdnfmrldkwkitilnkikesiqqqedd

SCOPe Domain Coordinates for d1qqea_:

Click to download the PDB-style file with coordinates for d1qqea_.
(The format of our PDB-style files is described here.)

Timeline for d1qqea_: