SCOP 1.65: Domain d1elra_: 1elr A:

Lineage for d1elra_ (1elr A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (2 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (8 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Hop [48456] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48457] (2 PDB entries)

8. Domain d1elra_: 1elr A: [19209]
   TPR2-domain
   complexed with ace, ni

Details for d1elra_

PDB Entry: 1elr, 1.9 Å

PDB Description: crystal structure of the tpr2a domain of hop in complex with the hsp90 peptide meevd

SCOP Domain Sequences for d1elra_:

Sequence; same for both SEQRES and ATOM records:

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens)}
gkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrel
cekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqq
aekilkeq

Timeline for d1elra_:

• d1elra_ first appeared (with stable ids) in SCOP 1.55
  
• d1elra_ appears in SCOP 1.63
  
• d1elra_ appears in SCOP 1.67
  
• d1elra_ appears in the current release, SCOPe 2.08