Lineage for d1elra_ (1elr A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6222Superfamily a.118.8: Tetratricopeptide repeat (TPR) [48452] (1 family) (S)
  5. 6223Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (5 protein domains)
  6. 6224Protein Hop [48456] (1 species)
  7. 6225Species Human (Homo sapiens) [TaxId:9606] [48457] (2 PDB entries)
  8. 6228Domain d1elra_: 1elr A: [19209]

Details for d1elra_

PDB Entry: 1elr (more details), 1.9 Å

PDB Description: crystal structure of the tpr2a domain of hop in complex with the hsp90 peptide meevd

SCOP Domain Sequences for d1elra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens)}
gkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrel
cekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqq
aekilkeq

SCOP Domain Coordinates for d1elra_:

Click to download the PDB-style file with coordinates for d1elra_.
(The format of our PDB-style files is described here.)

Timeline for d1elra_: