Lineage for d1elra_ (1elr A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726650Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2726672Protein Hop [48456] (1 species)
  7. 2726673Species Human (Homo sapiens) [TaxId:9606] [48457] (4 PDB entries)
  8. 2726677Domain d1elra_: 1elr A: [19209]
    TPR2-domain
    complexed with ni

Details for d1elra_

PDB Entry: 1elr (more details), 1.9 Å

PDB Description: crystal structure of the tpr2a domain of hop in complex with the hsp90 peptide meevd
PDB Compounds: (A:) tpr2a-domain of hop

SCOPe Domain Sequences for d1elra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}
gkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrel
cekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqq
aekilkeq

SCOPe Domain Coordinates for d1elra_:

Click to download the PDB-style file with coordinates for d1elra_.
(The format of our PDB-style files is described here.)

Timeline for d1elra_: