![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
![]() | Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) ![]() |
![]() | Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins) automatically mapped to Pfam PF02975 |
![]() | Protein automated matches [190303] (2 species) not a true protein |
![]() | Species Paracoccus denitrificans [TaxId:318586] [189284] (19 PDB entries) |
![]() | Domain d3swse_: 3sws E: [192089] Other proteins in same PDB: d3swsd_, d3swsf_ automated match to d2bbkl_ complexed with 1pe, act, ca, edo, hec, mes, na, pg4 |
PDB Entry: 3sws (more details), 1.86 Å
SCOPe Domain Sequences for d3swse_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3swse_ g.21.1.1 (E:) automated matches {Paracoccus denitrificans [TaxId: 318586]} tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi vgkas
Timeline for d3swse_: