Lineage for d3svwe_ (3svw E:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462380Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1462381Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1462382Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 1462403Protein automated matches [190303] (2 species)
    not a true protein
  7. 1462434Species Paracoccus denitrificans [TaxId:318586] [189284] (19 PDB entries)
  8. 1462442Domain d3svwe_: 3svw E: [192086]
    Other proteins in same PDB: d3svwd_, d3svwf_
    automated match to d2bbkl_
    complexed with act, ca, edo, hec, mes, na, peg, pge

Details for d3svwe_

PDB Entry: 3svw (more details), 1.86 Å

PDB Description: Crystal Structure of the P107V-MauG/pre-Methylamine Dehydrogenase Complex
PDB Compounds: (E:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3svwe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3svwe_ g.21.1.1 (E:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d3svwe_:

Click to download the PDB-style file with coordinates for d3svwe_.
(The format of our PDB-style files is described here.)

Timeline for d3svwe_: