Lineage for d3svwc1 (3svw C:7-131)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639172Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 2639173Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 2639174Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 2639175Protein Methylamine dehydrogenase [57563] (2 species)
  7. 2639176Species Paracoccus denitrificans [TaxId:266] [57564] (24 PDB entries)
  8. 2639181Domain d3svwc1: 3svw C:7-131 [192085]
    Other proteins in same PDB: d3svwc2, d3svwd_, d3svwf_
    automated match to d2bbkl_
    complexed with act, ca, edo, hec, mes, na, peg, pge

Details for d3svwc1

PDB Entry: 3svw (more details), 1.86 Å

PDB Description: Crystal Structure of the P107V-MauG/pre-Methylamine Dehydrogenase Complex
PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3svwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3svwc1 g.21.1.1 (C:7-131) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d3svwc1:

Click to download the PDB-style file with coordinates for d3svwc1.
(The format of our PDB-style files is described here.)

Timeline for d3svwc1: