SCOPe 2.03: Domain d3svwc_: 3svw C:

Lineage for d3svwc_ (3svw C:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
   automatically mapped to Pfam PF02975

6. Protein automated matches [190303] (2 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:318586] [189284] (19 PDB entries)

8. Domain d3svwc_: 3svw C: [192085]
   Other proteins in same PDB: d3svwd_, d3svwf_
   automated match to d2bbkl_
   complexed with act, ca, edo, hec, mes, na, peg, pge

Details for d3svwc_

PDB Entry: 3svw, 1.86 Å

PDB Description: Crystal Structure of the P107V-MauG/pre-Methylamine Dehydrogenase Complex

PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3svwc_:

Sequence; same for both SEQRES and ATOM records:

>d3svwc_ g.21.1.1 (C:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkashhhhhh

Timeline for d3svwc_:

• d3svwc_ first appeared in SCOPe 2.02
  
• d3svwc_ appears in SCOPe 2.04
  
• d3svwc_ appears in the current release, SCOPe 2.08, called d3svwc1