SCOPe 2.08: Domain d3svhb_: 3svh B:

Lineage for d3svhb_ (3svh B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein automated matches [190366] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (46 PDB entries)

8. Domain d3svhb_: 3svh B: [192084]
   automated match to d3p1fa_
   complexed with edo, krg

Details for d3svhb_

PDB Entry: 3svh, 1.8 Å

PDB Description: Crystal Structure of the bromdomain of human CREBBP in complex with a 3,5-dimethylisoxazol ligand

PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d3svhb_:

Sequence; same for both SEQRES and ATOM records:

>d3svhb_ a.29.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

Timeline for d3svhb_:

• d3svhb_ first appeared in SCOPe 2.02
  
• d3svhb_ appears in SCOPe 2.07