Lineage for d1elwb_ (1elw B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6222Superfamily a.118.8: Tetratricopeptide repeat (TPR) [48452] (1 family) (S)
  5. 6223Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (5 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 6224Protein Hop [48456] (1 species)
  7. 6225Species Human (Homo sapiens) [TaxId:9606] [48457] (2 PDB entries)
  8. 6227Domain d1elwb_: 1elw B: [19208]

Details for d1elwb_

PDB Entry: 1elw (more details), 1.6 Å

PDB Description: Crystal structure of the TPR1 domain of HOP in complex with a HSC70 peptide

SCOP Domain Sequences for d1elwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elwb_ a.118.8.1 (B:) Hop {Human (Homo sapiens)}
meqvnelkekgnkalsvgniddalqcyseaikldphnhvlysnrsaayakkgdyqkayed
gcktvdlkpdwgkgysrkaaaleflnrfeeakrtyeeglkheannpqlkeglqnm

SCOP Domain Coordinates for d1elwb_:

Click to download the PDB-style file with coordinates for d1elwb_.
(The format of our PDB-style files is described here.)

Timeline for d1elwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1elwa_