Lineage for d1elwb_ (1elw B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
  6. Protein Hop [48456] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48457] (4 PDB entries)
  8. Domain d1elwb_: 1elw B: [19208]
    TPR1-domain
    complexed with ni, trs

Details for d1elwb_

PDB Entry: 1elw (more details), 1.6 Å

PDB Description: Crystal structure of the TPR1 domain of HOP in complex with a HSC70 peptide
PDB Compounds: (B:) tpr1-domain of hop

SCOPe Domain Sequences for d1elwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elwb_ a.118.8.1 (B:) Hop {Human (Homo sapiens) [TaxId: 9606]}
meqvnelkekgnkalsvgniddalqcyseaikldphnhvlysnrsaayakkgdyqkayed
gcktvdlkpdwgkgysrkaaaleflnrfeeakrtyeeglkheannpqlkeglqnm

SCOPe Domain Coordinates for d1elwb_ are not available.

Timeline for d1elwb_:

Domains from other chains:
(mouse over for more information)
d1elwa_