Lineage for d1elwb_ (1elw B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2333769Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 protein domains)
  6. 2333791Protein Hop [48456] (1 species)
  7. 2333792Species Human (Homo sapiens) [TaxId:9606] [48457] (4 PDB entries)
  8. 2333794Domain d1elwb_: 1elw B: [19208]
    TPR1-domain
    complexed with ni, trs

Details for d1elwb_

PDB Entry: 1elw (more details), 1.6 Å

PDB Description: Crystal structure of the TPR1 domain of HOP in complex with a HSC70 peptide
PDB Compounds: (B:) tpr1-domain of hop

SCOPe Domain Sequences for d1elwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elwb_ a.118.8.1 (B:) Hop {Human (Homo sapiens) [TaxId: 9606]}
meqvnelkekgnkalsvgniddalqcyseaikldphnhvlysnrsaayakkgdyqkayed
gcktvdlkpdwgkgysrkaaaleflnrfeeakrtyeeglkheannpqlkeglqnm

SCOPe Domain Coordinates for d1elwb_:

Click to download the PDB-style file with coordinates for d1elwb_.
(The format of our PDB-style files is described here.)

Timeline for d1elwb_: