Lineage for d3srqx_ (3srq X:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2154171Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2154172Protein automated matches [190777] (21 species)
    not a true protein
  7. 2154373Species Staphylococcus aureus [TaxId:1280] [188848] (9 PDB entries)
  8. 2154375Domain d3srqx_: 3srq X: [192079]
    automated match to d2w9ga_
    complexed with nap, q19

Details for d3srqx_

PDB Entry: 3srq (more details), 1.69 Å

PDB Description: S. aureus Dihydrofolate Reductase complexed with novel 7-aryl-2,4-diaminoquinazolines
PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d3srqx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3srqx_ c.71.1.0 (X:) automated matches {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

SCOPe Domain Coordinates for d3srqx_:

Click to download the PDB-style file with coordinates for d3srqx_.
(The format of our PDB-style files is described here.)

Timeline for d3srqx_: