Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Matriptase MTSP1 [69284] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69285] (18 PDB entries) |
Domain d3so3a_: 3so3 A: [192078] Other proteins in same PDB: d3so3b1, d3so3b2 automated match to d3bn9a_ complexed with gol, suc |
PDB Entry: 3so3 (more details), 2.1 Å
SCOPe Domain Sequences for d3so3a_:
Sequence, based on SEQRES records: (download)
>d3so3a_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} vvggtdadegewpwqvslhalgqghicgaslispnwlvsaahcyiddrgfrysdptqwta flglhdqsqrsapgvqerrlkriishpffndftfdydiallelekpaeyssmvrpislpd ashvfpagkaiwvtgwghtqyggtgalilqkgeirvinqttcenllpqqitprmmcvgfl sggvdscqgdsggplssveadgrifqagvvswgdgcaqrnkpgvytrlplfrdwikentg v
>d3so3a_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} vvggtdadegewpwqvslhalgqghicgaslispnwlvsaahcyiddrgfrysdptqwta flglhdqsqrsapgvqerrlkriishpffndftfdydiallelekpaeyssmvrpislpd ashvfpagkaiwvtgwghtqyggtgalilqkgeirvinqttcenllpqqitprmmcvgfl sggvdscqgdsggplssvedgrifqagvvswgdgcaqrnkpgvytrlplfrdwikentgv
Timeline for d3so3a_: