SCOPe 2.04: Domain d3slee_: 3sle E:

Lineage for d3slee_ (3sle E:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
   automatically mapped to Pfam PF02975

6. Protein automated matches [190303] (3 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:318586] [189284] (19 PDB entries)

8. Domain d3slee_: 3sle E: [192077]
   automated match to d2bbkl_
   complexed with act, ca, edo, hec

Details for d3slee_

PDB Entry: 3sle, 2.52 Å

PDB Description: Crystal Structure of the P107C-MauG/pre-Methylamine Dehydrogenase Complex

PDB Compounds: (E:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3slee_:

Sequence; same for both SEQRES and ATOM records:

>d3slee_ g.21.1.1 (E:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

Timeline for d3slee_:

• d3slee_ first appeared in SCOPe 2.02
  
• d3slee_ appears in SCOPe 2.03
  
• d3slee_ appears in SCOPe 2.05
  
• d3slee_ appears in the current release, SCOPe 2.08